Anti-NT5C2 Antibody
Overview
This antibody is raised against a protein sequence from human NT5C2 (5′-nucleotidase, cytosolic II), an enzyme involved in purine metabolism through dephosphorylation of nucleoside monophosphates. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NT5C2 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human NT5C2 (5′-nucleotidase, cytosolic II)
- Validated application: Western blot (WB)
- Immunogen derived from a defined NT5C2 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NT5C2 (5′-nucleotidase, cytosolic II)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- KHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NT5C2 in human-derived samples. It may be used in research examining purine metabolism, nucleotide homeostasis, and cellular energy balance. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
