Anti-NT5E Antibody
Overview
This antibody is raised against a protein sequence from human NT5E (5′-nucleotidase, ecto), also known as CD73, a glycosylphosphatidylinositol-anchored enzyme involved in extracellular nucleotide metabolism. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NT5E in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human NT5E (ecto-5′-nucleotidase, CD73)
- Validated application: Western blot (WB)
- Immunogen derived from a defined NT5E protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NT5E (5′-nucleotidase, ecto; CD73)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of NT5E in human-derived samples. It may be used in research examining extracellular nucleotide metabolism, purinergic signalling, and cell surface enzyme expression. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
