Anti-NUDT16L1 Antibody
Overview
This antibody is raised against a defined protein sequence from human NUDT16L1 (nudix hydrolase 16-like 1), a member of the Nudix hydrolase family implicated in nucleotide metabolism. It is supplied within the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous NUDT16L1 in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human NUDT16L1 (nudix hydrolase 16-like 1)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined NUDT16L1 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- NUDT16L1 (nudix hydrolase 16-like 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of NUDT16L1 in human tissue sections. It may be used in research investigating nucleotide metabolism and cellular regulation mediated by Nudix hydrolases. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
