Anti-OCM Antibody
Overview
This antibody is raised against a defined protein sequence from human OCM (oncomodulin), a calcium-binding protein belonging to the parvalbumin family that is expressed in selected neuronal and sensory cell populations. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous OCM in human tissue samples. The manufacturer reports validation of this antibody for immunohistochemistry applications.
Highlights
- Antibody targeting human oncomodulin (OCM)
- Validated application: immunohistochemistry (IHC)
- Immunogen derived from a defined OCM protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- OCM (oncomodulin)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of oncomodulin in human tissue sections. It may be used in research examining calcium-binding proteins, sensory neuron biology, and neuronal subtype identification. Validation is not reported for applications beyond immunohistochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
