Anti-OIP5 Antibody
Overview
This antibody is raised against a defined protein sequence from human OIP5 (Opa interacting protein 5), a centromere-associated protein implicated in chromosome segregation and cell cycle progression. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous OIP5 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human Opa interacting protein 5 (OIP5)
- Validated application: Western blot (WB)
- Immunogen derived from a defined OIP5 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- OIP5 (Opa interacting protein 5)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of OIP5 in human-derived samples. It may be used in research examining centromere function, chromosome segregation, and regulation of the cell cycle. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
