Anti-OLIG2 Antibody
Overview
This antibody is raised against a defined protein sequence from human OLIG2 (oligodendrocyte lineage transcription factor 2), a basic helix–loop–helix transcription factor involved in neural development and oligodendrocyte differentiation. It is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio and is intended for detection of endogenous OLIG2 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Antibody targeting human oligodendrocyte lineage transcription factor 2 (OLIG2)
- Validated application: Western blot (WB)
- Immunogen derived from a defined OLIG2 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- OLIG2 (oligodendrocyte lineage transcription factor 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of OLIG2 in human-derived samples. It may be used in research examining neural lineage specification, oligodendrocyte development, and transcriptional regulation in the central nervous system. Validation is not reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
