Anti-PABPC4 Antibody
Overview
This antibody is raised against a defined protein sequence from human PABPC4 (poly(A) binding protein, cytoplasmic 4), an inducible RNA-binding protein involved in post-transcriptional regulation of gene expression. It belongs to the Atlas Antibodies Triple A Polyclonals range and is intended for detection of endogenous PABPC4 in human-derived samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Targets human poly(A) binding protein, cytoplasmic 4 (PABPC4)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PABPC4 protein sequence
- Supplied in a glycerol-containing phosphate buffer formulation
At-a-glance
- Target protein
- PABPC4 (poly(A) binding protein, cytoplasmic 4)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PABPC4 in human-derived samples. It may be applied in studies focusing on mRNA stability, translation control, and RNA–protein interactions. Validation has not been reported for applications beyond Western blot.
Sustainability
Rehoming surplus laboratory antibodies supports waste reduction and promotes more sustainable research practices.
