Anti-PAH Antibody
Overview
This antibody is directed against human phenylalanine hydroxylase (PAH), a cytosolic enzyme responsible for the conversion of phenylalanine to tyrosine. It is generated using a defined PAH-derived immunogen sequence and forms part of the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, this antibody has been validated for Western blot analysis.
Highlights
- Recognises human phenylalanine hydroxylase (PAH)
- Validated application: Western blot (WB)
- Immunogen based on a defined PAH protein region
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PAH (phenylalanine hydroxylase)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- IGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQ
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot analysis of PAH expression in human-derived samples. It can support research into amino acid metabolism and related cellular pathways. Use is limited to the application validated by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
