Anti-PAPD7 Antibody
Overview
This antibody is raised against a defined region of the human PAP associated domain containing 7 (PAPD7), a protein implicated in RNA metabolism and post-transcriptional regulation. It is part of the Atlas Antibodies Triple A Polyclonals collection and is designed for detection of endogenous PAPD7 in human samples. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Targets human PAP associated domain containing 7 (PAPD7)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PAPD7 protein sequence
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PAPD7 (PAP associated domain containing 7)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PAPD7 in human-derived samples. It may be used in research investigating RNA processing, stability, and associated regulatory pathways. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
