Anti-PARD3 Antibody
Overview
This antibody targets human PARD3 (partitioning defective 3), a scaffold protein involved in cell polarity and tight junction organisation. It is generated against a defined PARD3-derived immunogen and supplied as part of the Atlas Antibodies Triple A Polyclonals range. According to the manufacturer, this antibody has been validated for immunohistochemistry applications.
Highlights
- Recognises human par-3 family cell polarity regulator (PARD3)
- Validated application: Immunohistochemistry (IHC)
- Immunogen based on a defined region of the PARD3 protein
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PARD3 (par-3 family cell polarity regulator)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PARD3 in human tissue samples. It can support studies of epithelial polarity, junctional complexes, and tissue organisation. Use is limited to the application validated by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
