Anti-PCCA Antibody
Overview
This antibody is raised against human propionyl-CoA carboxylase alpha subunit (PCCA), a mitochondrial enzyme involved in branched-chain amino acid and odd-chain fatty acid metabolism. It is generated using a defined PCCA-derived immunogen sequence and is supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, this antibody is validated for Western blot analysis.
Highlights
- Targets human propionyl-CoA carboxylase alpha subunit (PCCA)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PCCA protein region
- Formulated in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PCCA (propionyl-CoA carboxylase, alpha polypeptide)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- YPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNY
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PCCA in human-derived samples. It may support research into mitochondrial metabolism and inborn errors of metabolism. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
