Anti-PCNA Antibody
Overview
This antibody targets human proliferating cell nuclear antigen (PCNA), a key factor in DNA replication and cell cycle regulation. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human PCNA protein
- Sequence-defined peptide immunogen
- Validated for WB or IHC depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Proliferating cell nuclear antigen (PCNA)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
- Validated applications
- WB (SKU: HPA030521WB); IHC (SKU: HPA030521IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection or localisation of PCNA in human samples by western blot or immunohistochemistry. Supports studies of cell proliferation and DNA replication.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
