Anti-PERM1 Antibody
Overview
This antibody is directed against human PERM1 (PPARGC1 and ESRR induced regulator, muscle 1), a protein associated with muscle metabolism and transcriptional regulation. It is raised against a defined PERM1-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, this antibody has been validated for immunohistochemistry.
Highlights
- Targets human PERM1 (PPARGC1 and ESRR induced regulator, muscle 1)
- Validated application: Immunohistochemistry (IHC)
- Immunogen based on a defined region of the PERM1 protein
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PERM1 (PPARGC1 and ESRR induced regulator, muscle 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PERM1 in human tissue samples. It may be applied in studies of muscle biology, metabolic regulation, and transcriptional control. Use is limited to the application validated by the manufacturer.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
