Anti-PIEZO2 Antibody
Overview
This antibody is directed against human PIEZO2 (piezo-type mechanosensitive ion channel component 2), a large transmembrane protein involved in mechanotransduction. It is raised against a defined PIEZO2-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation of this antibody for immunocytochemistry.
Highlights
- Targets human piezo-type mechanosensitive ion channel component 2 (PIEZO2)
- Validated application: Immunocytochemistry (ICC)
- Immunogen derived from a defined region of the PIEZO2 protein
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PIEZO2 (piezo-type mechanosensitive ion channel component 2)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- QFQFFQEAVPPNDYYARLFGIKSVIQTDCSSTWKIIVNPDLS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is suitable for immunocytochemical detection of PIEZO2 in human-derived cell samples. It may support research into mechanosensation, ion channel biology, and sensory signalling pathways. Validation has not been reported for applications beyond immunocytochemistry.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
