Anti-PITX3 Antibody
Overview
This antibody is directed against human PITX3 (paired-like homeodomain 3), a transcription factor involved in developmental processes and cellular differentiation. It is generated using a defined PITX3-derived immunogen sequence and supplied as part of the Atlas Antibodies Triple A Polyclonals portfolio. The manufacturer reports validation of this antibody for Western blot analysis.
Highlights
- Targets human paired-like homeodomain 3 (PITX3)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PITX3 protein region
- Formulated in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PITX3 (paired-like homeodomain 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLK
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PITX3 in human-derived samples. It may support research into transcriptional regulation and developmental biology. Validation has not been reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
