Anti-PLA2G10 Antibody
Overview
This antibody targets human PLA2G10 (phospholipase A2, group X), a secreted enzyme involved in phospholipid metabolism and lipid signaling pathways. The antibody is generated using a defined PLA2G10-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals collection. According to the manufacturer, it is validated for Western blot analysis.
Highlights
- Recognizes human phospholipase A2, group X (PLA2G10)
- Validated application: Western blot (WB)
- Immunogen derived from a specific PLA2G10 protein region
- Supplied in a glycerol-containing phosphate buffer
At-a-glance
- Target protein
- PLA2G10 (phospholipase A2, group X)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- ASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCH
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PLA2G10 in human samples. It may be useful in studies related to lipid metabolism and inflammatory signaling. Use is limited to the application validated by the manufacturer.
Sustainability
Listing surplus antibodies helps extend product life cycles and supports more sustainable laboratory practices.
