Product Details
- Manufacturer
- Atlas Antibodies
About this product
Anti-PLIN3 Antibody
Overview
This antibody targets human PLIN3 (perilipin 3), a lipid droplet–associated protein involved in lipid storage, trafficking, and cellular lipid metabolism. The antibody is raised against a defined PLIN3-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. The manufacturer reports validation exclusively for Western blot analysis.
Highlights
- Recognizes human perilipin 3 (PLIN3)
- Validated application: Western blot (WB)
- Immunogen derived from a specific region of the PLIN3 protein
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PLIN3 (perilipin 3)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PLIN3 in human-derived samples. It can support studies of lipid droplet biology, intracellular lipid handling, and metabolic regulation. No validation data are available for applications beyond Western blot.
Sustainability
Reusing surplus research antibodies helps reduce laboratory waste and supports more sustainable scientific research practices.
Related Products
What Our Clients Say
Supporting innovation at leading research companies
RNAnalytics
Leading The Way In Gene Therapy Analytics
As a startup focused on developing analytical toolkits for LNP characterization, RNAnalytics operates under tight budget constraints while striving to maintain a fully stocked lab with high-quality materials. Sustainability is also a core pillar of our operations, pushing us to make environmentally conscious decisions wherever possible....