Anti-PRELID1 Antibody
Overview
This antibody targets human PRELID1 (PRELI domain containing 1), a mitochondrial protein implicated in phospholipid transport and mitochondrial membrane organisation. It is raised against a defined PRELID1-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals portfolio. Manufacturer validation is reported exclusively for immunohistochemistry.
Highlights
- Recognises human PRELID1
- Validated application: immunohistochemistry (IHC)
- Defined peptide immunogen sequence
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRELID1 (PRELI domain containing 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PRELID1 in human tissue samples. It may support studies focused on mitochondrial lipid transport, membrane dynamics, and cellular energy metabolism. No validation is available for applications beyond IHC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
