Anti-PRPF4B Antibody
Overview
This antibody targets human PRPF4B (pre-mRNA processing factor 4B), a serine/threonine kinase associated with spliceosome assembly and regulation of pre-mRNA splicing. It is raised against a defined PRPF4B-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals collection. According to the manufacturer, validation is limited to Western blot analysis.
Highlights
- Recognises human pre-mRNA processing factor 4B (PRPF4B)
- Validated application: Western blot (WB)
- Immunogen derived from a specific PRPF4B protein region
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRPF4B (pre-mRNA processing factor 4B)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMF
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot detection of PRPF4B in human-derived samples. It can support research into RNA splicing mechanisms, spliceosome-associated kinases, and post-transcriptional gene regulation. No validation is reported for applications beyond Western blot.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
