Anti-PRRX1 Antibody
Overview
This antibody targets human PRRX1 (paired related homeobox 1), a transcription factor involved in developmental processes and cellular differentiation. It is raised in rabbit against a PRRX1-derived immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, this product is validated exclusively for immunocytochemistry (ICC).
Highlights
- Specific for human paired related homeobox 1 (PRRX1)
- Validated application: Immunocytochemistry (ICC)
- Rabbit polyclonal antibody
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRRX1 (paired related homeobox 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunocytochemistry (ICC)
- Immunogen sequence
- NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for ICC application
Applications
This antibody is intended for immunocytochemical detection of PRRX1 in human cell samples. It may be useful in studies of transcriptional regulation, developmental biology, and cell fate determination. Use in applications other than ICC has not been validated by the manufacturer.
Sustainability
Listing surplus reagents helps extend the useful life of high-quality research materials and supports more sustainable laboratory practices.
