Anti-PRSS23 Antibody
Overview
This antibody targets human PRSS23 (protease, serine, 23), a secreted serine protease associated with extracellular matrix remodeling and cellular signaling processes. It is a rabbit polyclonal antibody generated against a defined PRSS23 immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals collection. Manufacturer validation is limited to immunohistochemistry (IHC).
Highlights
- Recognizes human serine protease PRSS23
- Validated application: Immunohistochemistry (IHC)
- Rabbit polyclonal antibody
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PRSS23 (protease, serine, 23)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is intended for immunohistochemical detection of PRSS23 in human tissue sections. It may support research into protease activity, tissue remodeling, and disease-associated expression patterns. Performance in applications other than IHC has not been validated.
Sustainability
Reusing surplus antibodies helps reduce laboratory waste while maintaining access to high-quality research reagents.
