Anti-PSMB1 Antibody
Overview
This antibody targets human PSMB1 (proteasome subunit beta type 1), a core component of the 20S proteasome complex involved in intracellular protein degradation. It is a rabbit polyclonal antibody generated against a defined PSMB1 immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals portfolio. Manufacturer validation is limited to immunohistochemistry (IHC).
Highlights
- Recognizes human PSMB1, a proteasome beta subunit
- Validated application: Immunohistochemistry (IHC)
- Rabbit polyclonal antibody
- Supplied in a glycerol-based phosphate buffer
At-a-glance
- Target protein
- PSMB1 (proteasome subunit beta type 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PSMB1 in human tissues, supporting research into proteasome biology, protein turnover, and related cellular pathways. Use in applications other than IHC has not been validated by the manufacturer.
Sustainability
Reusing surplus antibodies through Wasteless Bio helps reduce laboratory waste while extending the lifecycle of high-quality research reagents.
