Anti-PTDSS1 Antibody
Overview
This antibody targets human PTDSS1 (phosphatidylserine synthase 1), an endoplasmic reticulum–associated enzyme involved in phosphatidylserine biosynthesis and membrane lipid homeostasis. It is raised against a defined PTDSS1-derived immunogen sequence and is part of the Atlas Antibodies Triple A Polyclonals range. According to the manufacturer, validation is limited to immunohistochemistry (IHC).
Highlights
- Recognises human phosphatidylserine synthase 1 (PTDSS1)
- Validated application: Immunohistochemistry (IHC)
- Immunogen derived from a defined PTDSS1 protein region
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PTDSS1 (phosphatidylserine synthase 1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Immunohistochemistry (IHC)
- Immunogen sequence
- AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for IHC application
Applications
This antibody is suitable for immunohistochemical detection of PTDSS1 in human tissue samples. It may support studies of membrane lipid biosynthesis, phospholipid homeostasis, and lipid-associated cellular pathways. Validation has not been reported for applications beyond IHC.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
