Anti-PTGER4 Antibody
Overview
This antibody targets human PTGER4 (prostaglandin E receptor 4, also known as EP4), a G protein–coupled receptor involved in prostaglandin E2 signalling and regulation of immune, inflammatory, and cellular proliferation pathways. The antibody is raised against a defined PTGER4-derived immunogen sequence and belongs to the Atlas Antibodies Triple A Polyclonals portfolio. According to the manufacturer, validation is limited to Western blot (WB) applications.
Highlights
- Recognises human prostaglandin E receptor 4 (PTGER4 / EP4)
- Validated application: Western blot (WB)
- Immunogen derived from a defined PTGER4 protein region
- Supplied in a glycerol-based phosphate buffer formulation
At-a-glance
- Target protein
- PTGER4 (prostaglandin E receptor 4)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV
- Buffer composition
- 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for Western blot–based detection of PTGER4 in human samples. It may support studies of prostaglandin signalling, GPCR-mediated pathways, and inflammation-related cellular responses. Validation has not been reported for applications beyond Western blotting.
Sustainability
By rehoming surplus laboratory reagents, this listing helps reduce research waste while extending the usable life of high-quality antibodies.
