Anti-PTPRZ1 Antibody
Overview
This antibody targets protein tyrosine phosphatase receptor type Z1 (PTPRZ1), a receptor-type phosphatase implicated in signal transduction and nervous system development. It is a rabbit polyclonal antibody raised against a defined human PTPRZ1 immunogen sequence. The manufacturer validates this antibody for use in Western blot (WB) applications.
Highlights
- Specific for human PTPRZ1 (receptor-type protein tyrosine phosphatase Z1)
- Rabbit polyclonal antibody
- Validated for Western blot analysis
- Defined immunogen sequence provided by manufacturer
At-a-glance
- Target
- Protein tyrosine phosphatase, receptor-type Z polypeptide 1 (PTPRZ1)
- Host species
- Rabbit
- Clonality
- Polyclonal
- Validated applications
- Western blot (WB)
- Immunogen sequence
- LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLIT
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused
Applications
This antibody is suitable for detection of PTPRZ1 in protein samples by Western blotting. It may support research into receptor-type tyrosine phosphatase signalling, particularly in studies related to neural tissues and intracellular signalling mechanisms.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
