Anti-PUS7L Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody targets human pseudouridylate synthase 7-like protein (PUS7L), a homolog of the yeast Pus7 enzyme. It is generated against a defined amino acid sequence to enable selective detection of the endogenous protein. The antibody is supplied in a buffered liquid formulation.
Highlights
- Rabbit polyclonal antibody against human PUS7L
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid formulation with preservative
At-a-glance
- Target
- Pseudouridylate synthase 7-like (PUS7L)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- YAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKVPTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIM
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of PUS7L expression in human-derived samples. It can support studies of RNA modification enzymes and related cellular pathways.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
