Anti-PVALB Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody recognises human parvalbumin (PVALB), a calcium-binding protein expressed in specific neuronal and muscle cell populations. The antibody is raised against a defined protein sequence to support selective immunodetection. It is supplied as a liquid reagent.
Highlights
- Rabbit polyclonal antibody targeting parvalbumin
- Sequence-specific antigen design
- Validated for western blot analysis
- Buffered glycerol-based formulation
At-a-glance
- Target
- Parvalbumin (PVALB)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of parvalbumin in human samples. It is useful for research into calcium signalling and cell-type-specific protein expression.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
