Anti-RAB5C Antibody
Overview
This antibody targets human RAB5C, a member of the RAS oncogene family involved in early endosomal trafficking. It is generated using a sequence-defined immunogen to support selective detection of the endogenous protein. The antibody is supplied as a liquid formulation.
Highlights
- Targets human RAB5C protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Glycerol-based liquid formulation
At-a-glance
- Target
- RAB5C, member RAS oncogene family
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of RAB5C expression in human-derived samples. It supports research into vesicle trafficking and endocytic pathway regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
