Anti-RACK1 Antibody
Overview
This antibody targets human receptor for activated C kinase 1 (RACK1), a scaffolding protein involved in signal transduction and ribosomal function. It is generated against a sequence-specific immunogen for selective detection. The antibody is supplied as a liquid reagent.
Highlights
- Targets human RACK1 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Receptor for activated C kinase 1 (RACK1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot detection of RACK1 in human samples. It supports research into protein kinase signalling and translational regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
