Anti-RBL2 Rabbit Polyclonal Antibody
Overview
This rabbit polyclonal antibody recognises human retinoblastoma-like protein 2 (RBL2), a cell cycle regulator involved in transcriptional control. It is generated against a defined immunogen sequence to support selective detection. The antibody is supplied as a liquid reagent.
Highlights
- Rabbit polyclonal antibody targeting RBL2
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- Retinoblastoma-like 2 (RBL2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- IAGSPLTPRRVTEVRADTGGLGRSITSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQV
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot analysis of RBL2 in human samples. It supports studies of cell cycle regulation and tumour suppressor pathways.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
