Anti-RBPMS Antibody
Overview
This antibody targets human RNA binding protein with multiple splicing (RBPMS), which plays a role in RNA processing and cytoskeletal regulation. It is generated using a sequence-defined immunogen to support selective protein detection. The antibody is supplied as a liquid reagent.
Highlights
- Targets human RBPMS protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- RNA binding protein with multiple splicing (RBPMS)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- PSTPLPNTVPQFIAREPYELTVPALYPSSPEV
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of RBPMS in human-derived samples. It supports studies of RNA-binding proteins and cytoskeletal-associated signalling.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
