Anti-RECQL4 Antibody
Overview
This antibody targets human RecQ protein-like 4 (RECQL4), a DNA helicase involved in DNA replication and repair. It is generated against a defined immunogen sequence to support selective detection of the target protein. The antibody is supplied as a liquid reagent.
Highlights
- Targets human RECQL4 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- RecQ protein-like 4 (RECQL4)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- WLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGE
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of RECQL4 in human-derived samples. It supports research into DNA replication, repair, and genome maintenance.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
