Anti-SEC23IP Antibody
Overview
This antibody recognises human SEC23 interacting protein (SEC23IP), which participates in COPII-mediated vesicle transport from the endoplasmic reticulum. It is raised against a defined immunogen sequence to support selective protein detection. The antibody is supplied in liquid format.
Highlights
- Targets human SEC23IP protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- SEC23 interacting protein (SEC23IP)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- HLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGML
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of SEC23IP in human samples. It supports research into intracellular trafficking and secretory pathway regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
