Anti-SERBP1 Antibody
Overview
This antibody recognises human SERPINE1 mRNA binding protein 1 (SERBP1), which regulates mRNA stability and translational control. It is raised against a defined immunogen sequence to support selective detection. The antibody is supplied in liquid format.
Highlights
- Targets human SERBP1 protein
- Sequence-defined immunogen
- Validated for western blot (WB)
- Liquid buffered formulation
At-a-glance
- Target
- SERPINE1 mRNA binding protein 1 (SERBP1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- GHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFE
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is intended for western blot detection of SERBP1 in human samples. It supports research into post-transcriptional gene regulation.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
