Anti-SLC35A2 Antibody
Overview
This antibody targets human solute carrier family 35 member A2 (SLC35A2), a UDP-galactose transporter involved in glycosylation processes. It is generated using a sequence-defined immunogen to support selective detection.
Highlights
- Targets human SLC35A2 protein
- Sequence-specific immunogen
- Validated for western blot (WB)
- Buffered glycerol-based formulation
At-a-glance
- Target
- Solute carrier family 35 member A2 (SLC35A2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
- Recommended application
- WB
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — The product is only validated for WB application
Applications
This antibody is suitable for western blot analysis of SLC35A2 in human-derived samples. It supports research into protein glycosylation and Golgi transport.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
