Anti-TJP1 Antibody
Overview
This antibody targets human tight junction protein 1 (TJP1), also known as ZO-1, a key adaptor protein linking transmembrane junctional proteins to the actin cytoskeleton. It is generated against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Recognises human TJP1 (ZO-1)
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Tight junction protein 1 (TJP1 / ZO-1)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
- Validated applications
- WB (SKU: HPA001636WB); IHC (SKU: HPA001636IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Suitable for detection and localisation of TJP1 in human samples by western blot or immunohistochemistry. Commonly used in studies of tight junction organisation and epithelial integrity.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
