Anti-UBQLN2 Antibody
Overview
This antibody recognises human ubiquilin 2 (UBQLN2), a ubiquitin-like protein involved in proteasomal protein degradation and cellular protein quality control. It is raised against a sequence-defined immunogen and supplied as a liquid formulation. Separate SKUs are validated for western blotting or immunohistochemistry.
Highlights
- Targets human UBQLN2 protein
- Sequence-defined peptide immunogen
- Validated for Western Blot (WB) or Immunohistochemistry (IHC) depending on SKU
- Liquid antibody formulation
At-a-glance
- Target
- Ubiquilin 2 (UBQLN2)
- Host
- Rabbit
- Clonality
- Polyclonal
- Immunogen sequence
- LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN
- Validated applications
- WB (SKU: HPA006431WB); IHC (SKU: HPA006431IHC)
- Buffer composition
- 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
- Condition
- New / Unused — Each SKU is validated only for its stated application
Applications
Used for detection or localisation of UBQLN2 in human samples by western blot or immunohistochemistry, depending on product variant. Supports studies of ubiquitin-mediated protein turnover and proteostasis.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
