TRAIL-R3 (h) pAb
Overview
Also known as TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C.
Highlights
- Applications: Flow Cytometry, ICC, IHC (PS), WB
- Host: Goat
- Long-term storage: -20°C
At-a-glance
- Host Species
- Goat
- Immunogen
- Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.
- Recommended Applications
- Flow Cytometry, ICC, IHC (PS), WB
- Form
- Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
- UniProt ID
- O14798
- Storage Condition
- Long-term: -20°C; Shipping: Blue Ice; For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.
- Condition
- Surplus/second-hand; stored under manufacturer-recommended conditions.
Applications
Suitable for Flow Cytometry, ICC, IHC (PS), WB and related immunological research applications.
Sustainability
By rehoming surplus lab products, this listing supports waste reduction and resource efficiency.
Responsible use & safety
- Require training/authorization before use.
- Handle with appropriate PPE; consult Safety Data Sheet for hazard details.
- Follow manufacturer guidelines for storage and handling.
